PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_139448g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 374aa    MW: 41856.2 Da    PI: 6.7258
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_139448g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ ++++G g+W++ a+  g+ R++k+c++rw +yl
   MA_139448g0010 16 KGPWTFEEDLRLLRHIRLHGEGRWSALAKAAGLQRCGKSCRLRWVNYL 63
                     79********************************************97 PP

2Myb_DNA-binding55.61.2e-1769113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T+eE++ ++d+++++G++ W++Ia++m+ gRt++++k++w+ +
   MA_139448g0010  69 RGNITPEEEQVIIDLHARWGNR-WSLIAERMP-GRTDNEIKNYWRCH 113
                      7999******************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-231066IPR009057Homeodomain-like
PROSITE profilePS5129415.8581163IPR017930Myb domain
SuperFamilySSF466894.77E-3014110IPR009057Homeodomain-like
SMARTSM007175.4E-141565IPR001005SANT/Myb domain
PfamPF002496.6E-151663IPR001005SANT/Myb domain
CDDcd001671.07E-111863No hitNo description
PROSITE profilePS5129426.36864118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2567118IPR009057Homeodomain-like
SMARTSM007176.3E-1768116IPR001005SANT/Myb domain
PfamPF002492.3E-1569111IPR001005SANT/Myb domain
CDDcd001678.09E-1373114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNPRWALSAE KGKLKKGPWT FEEDLRLLRH IRLHGEGRWS ALAKAAGLQR CGKSCRLRWV  60
NYLRPDLKRG NITPEEEQVI IDLHARWGNR WSLIAERMPG RTDNEIKNYW RCHLKKKLQY  120
TADNSNGSQY CNLPLSLQQE FKNKQTPTAP LEPHLQQVTA GNANGSQYCN LPLSLQQEFK  180
NKQTPTAPLE PHLQQVTAGN ASVIYENKHC SASAGVELEI PMLSSSTPQE VYRNGSVITG  240
NSDLEDTETD YIAQRGGNTL SALVTGSEPI QKEMVGSELV DALPSILYRF PSGIPIEDDA  300
ARILQVSSRA NLNPTGTADP AHYLYPQYGC ELEYSGLDLG SDIMLWNLCP SPAISQCELH  360
SPFPYTCDSN THHM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271411825128MYB TRANSFORMING PROTEIN
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-53myb domain protein 79